Skip to content

nerrull/BetaBarrelRefactor

Repository files navigation

3D-BMPP refactor

This is a refactor of the 3D Beta-barrel Membrane Protein Predictor code by Wei Tian.

The original source code is available at : http://sts.bioe.uic.edu/3dbmpp/

The author's pipeline can be found at : https://github.com/jksr/3dbmpp

Citation

High-resolution structure prediction of beta-barrel membrane proteins. W Tian, M Lin, K Tang, J Liang, H Naveed. Proceedings of the National Academy of Sciences 115 (7), 1511-1516

Please cite the paper if you use 3DBMPP in your research.

    @article {Tian201716817,
        author = {Tian, Wei and Lin, Meishan and Tang, Ke and Liang, Jie and Naveed, Hammad},
        title = {High-resolution structure prediction of β-barrel membrane proteins},
        year = {2018},
        doi = {10.1073/pnas.1716817115},
        publisher = {National Academy of Sciences},
        issn = {0027-8424},
        URL = {http://www.pnas.org/content/early/2018/01/25/1716817115},
        eprint = {http://www.pnas.org/content/early/2018/01/25/1716817115.full.pdf},
        journal = {Proceedings of the National Academy of Sciences}
    }

Requirements

SCRWL

Sidechain prediction relies on SCWRL. To download scwrl, you must apply for a license on their website. We then recommend unpacking it into a folder name scwrlin the top level folder of this repo. You can also change the path to an absolute path on line 38 of defs.py.

You also need to chage line 3 in scrwl/Scwrl4.ini to FilePath = [absolute path to scwrl]/bbDepRotLib.bin

Python

Python requirements: numpy, pandas, biopython

pip install -r requirements.txt to install required python packages.

The code was developed using python 2.7 but should be compatible with python 3.

Compiling

Part of the application is written in C and needs to be compiled. In a terminal from the main folder:

cd bb_register/pred_combine/
make

If you're getting an error while trying to run the program that says something like Can't find file construction_inputs/results/regs/*.regs you probably forgot to do this step.

Usage

To predict beta-barrel structure, you must provide a fasta file with the protein sequence as well as the identified transmembrane strands. See the example at the end of this readme and example_fasta.txt for reference. You can also provide a fasta file with multiple sequences and they will be processed individually.

The transmembrane strands are NOT predicted by our tool. We recommend using PRED-TMBB2 to predict the transmembrane strands beforehand.

These files will be processed in order to create the appropriate files for the predictor in the inputs/ directory. For example, if we predict structure for the example fast file which contains a protein named A9WGN5_CHLAA the inputs/ directory will end up looking like this:

|-inputs/
    |- A9WGN5_CHLAA/
        |- A9WGN5_CHLAA.res
        |- A9WGN5_CHLAA.strands
        |- A9WGN5_CHLAA.tmregs
        |- A9WGN5_CHLAA.tmstrands
        

Feel free to clean up the inputs directory between runs.

Running the code

From a shell terminal call: python main.py -f [fastafile]

to predict the beta barrel structure. The newly created pdb files can be found in output/ and can be inspected using PyMOL.

Other parameters:

--level or -l : [1-5] or -1 *This changes the set of hyperparameters used during register prediction.

A detailed description of these parameters can be found on page 2 of the appendix in docs/. If the parameter is set to -1, a predicted structure is generated with parameters for each level. The level of parameters used is identified in output files by a _l0[#] suffix.

When the parameter is not defined, we infer the level based on the number of transmembrane strands (N) in the provided input file.

  • For N<16, 2 barrels are predicted using both levels 1 and 2
  • For 16 <= N < 20, 2 barrels are predicted using levels 3 and 4

Quick reference :

  • 1 : Small BMPs (N < 16) without inplugs or outclamps
  • 2 : Small BMPs (N < 16) with inplugs or outclamps
  • 3 : Medium oligomeric BMPs (16 <= N < 20)
  • 4 : Medium monomeric BMPs (16 <= N < 20)
  • 5 : Large BMPs (N >= 20)

Example fasta file

>tr|A9WGN5|A9WGN5_CHLAA
MTMINRSRLTIFALLLTGILGSIIAIWSWSANAQTASLTVSPTVARQNTTVTLYGSGFVP
GEKVSIWITYPDYTVYGVTVLTIDERGQFSHPYLPDFLGATFTPTGRYTYTARGWQSGRE
AYASIDVDIAPAPGTTAGVQLTVDRAVQTQGNTFTFSGSGYKPGERVALWLRYPNNAVAD
LGVQIADGQGRIGLAIDSNGVPVGRYALTARGLQSGGNGIVEFEVQVGDALRPRGTAGLE
VGPGSSQQRSAVSLRGTGFLPGEVITIWATRPDYSTEWLGDVTAAADGSFTTELYLSEQN
PAGRYAFSAYGNRSERRAVAEYTLLPGR
>tr|A9WGN5|A9WGN5_CHLAA
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOMMMMMMMMMI
IIMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMMIIMMMMMMMMMMMOOOOOOOOOO
MMMMMMMMMIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMMM
MOOOOOOOOOOOOMMMMMMMIIMMMMMMMMMOOOOOOMMMMMMMMMIIMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOMMMMMMMMMMM

The two lines starting with >tr|[short]|[full] indicate a shortened version of the protein name and its full name. The first is followed by a line containing the amino acid sequence. The second identifying line is followed by the transmembrane strand prediction, where each amino acid is predicted as being either inner (I), outer (O), or transmembrane(M).

Adding loops with MODELLER

After building the beta barrels, the program will print the command to run Modeller for adding the loops to the transmembrane strands already modelled. By default, 100 models are generated but this can be changed with the -n parameter. We recommend looking at the generated transmembrane strands if you have used more than one "level" parameter, and choosing the one that seems the most realistic beta-barrel for modelling the loops. python ./LoopModeller.py -b A9WGN5_CHLAA_ext_l03 -l 3 -n 100

About

No description, website, or topics provided.

Resources

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages